Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD028658 [Oryza sativa subsp. indica] Chr09_2139,2301,,,1,2301, protein sequence BLAST
MSQIQSFSRQNCVLLAVLCGKHAEKRAQARSGPEAKRLRPSYPFPELSSSGRLEVHTLFNPTPEQFLEAQRVVQPNFLYI
QGQQLEDEKEIGSLVWGDNDVSDPQAFSCLISPPFPTIVYLEVPIGEKLAQAVHSKGIPYVIYWRNSFSSYAASHFRHAL
MSVVQSSVSHTWDAFQLAHASFRLYCVRNNHVQSVKLGPRLLGDAPKINITPPENEMVEEEGSSDVFPAIKIYDDDINMK
FLLCGVPSTPDPCLLGSLEDGLNALLNIEIRGCKLQNRISASPPPLHAASLPRGMVTMRCDITTCSSSHVSLLVSGSAQT
CFDDQLLESHIKDEIIEKSQLVHALPNNDDKLSSIVPFTSMSTACGASTFEVWMTLPKWAAQVLKHLAPDISYRSLVALG
IGCINGTPVASFDRRDADRLLFFCTNQHKDLAIENGPYFHLPRWSASLTKERVKVGLESKPKLLGANGIPEDKKRLIEGP
SSSSKAKLKPATMRPIPHSRKQQMHPFMGFLEATVHETSQVKPNLPAAPPVKHNSVPAAPTTHRKSTSGPSHAQSIIQLN
PLPLKKHGCDRLPIQMCSEEDFLKDVMQFLIQRGHNRLVPHGGLAEFPEAVLNAKRLDLYNLYKEVVSRGGFYVGNGINW
KGQVFSKMRNHTVTNRMTGVGNTLKRHYETYLLEYELAHDDVDGECCLLCHSSAPGDWVNCGLCGEWAHFGCDRRQGLGT
FKDYAKTDGLEYICPHCSLANYKKKPPPPQKVANGFANTVSVSRNV