Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT5G20510.1 [Arabidopsis thaliana]  PHD finger family protein  protein sequence BLAST
MEGGTAHYSPRTVEEVFRDFKGRRAGIIQALTTDVEDFFQQCDPEKQNLCLYGFPNEVWEVNLPAEEVPPELPEPALGIN
FARDGMQERNWLSLVAVHSDAWLLSVSFYFGSRFGFDRADRKRLFSMINEVPTVYEVVTGNAEKQTKEMPSSANQNGNRS
KSNSKMRGLESKSSKTIHAKDEEEGLELEEGEEEEDEDEDEHGETLCGACGDNYASDEFWICCDMCEKWFHGECVKITPA
RAEHIKHYKCPTCSNKRARP*