Plant Transcription factor database - Universität Potsdam
version: 3.0

Zea mays Transcription Factor Database


>GRMZM2G038066_P01 [Zea mays]   protein sequence BLAST
MDSGYNPRTVEEVFRDFKGRRAGIIRALTTDAEDFFKQCDPEKENLCLYGFPNESWEVNLPAEEVPPDLPEPALGINFAR
DGMQEKEWLSMVAAHSDAWLLSVAFYFGARFGFNKNDRKRLYSLIDDLPMAFEIVSGKSETKAPAPPSSSNHSNIKPKSN
NKKKPPEPKVKQPKPRAPAEEGEEEDGSASEGEHGETLCGACKESYGPDEFWICCDLCEKWFHGKCVKITAAKAEHIKQY
KCPSCTGGGGVSNSGTKRARPS