Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>591830 [Populus trichocarpa]  eugene3.00400175 protein sequence BLAST
MTSDGATSTSAAMAAATRRKPSWRERENNRRRERRRRAIAAKIFTGLRAQGNYNLPKYCDNNEVLKALCAEAGWVVEEDG
TTYRKGHRPPPIEIVGTSTRVTPYSSQNPSPLSSLFPSPIPSYQASPSSSSFPSPTRGDNNASSNLLPFLRSAIPLSLPP
LRISNSAPVTPPLSSPTSRNPKPIPNWDFIAKQSMASFSYPFNAVSAPASPTHRQFHAPATIPECDESDTSTVESGQWIS
FQKFAPSVAAAMPTSPTYNLVIPVAQQISSSNLVKESAVPMDFEFGSEQVKPWEGERIHEVGLDDLELTLGSGKAQS*