Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>894683 [Arabidopsis lyrata]  scaffold_201757.1 protein sequence BLAST
MEDLWKRAKSFAEEAAKKSQTITLQSSSTTFVNLVSETAKKSKEFALEASKKADSLNVSEFVAETAKKSKEFAAEVSTKA
DQLKVVALKQADQIQNIKSIADIIPGGLGSGSGGGGSVISESELVSFGITDDLREFVKGLTSATFQAFPVQDESSQVSDL
ETSASNVRKDLSEWQERHATLVLGSVKQISKLRYELCPRVMKERRFWRIYFTLVSTHVAPYERKYMEELRSKAGSKDEEA
KKSPGVGGTELAEKNVTMNRTSTASSEQDLDTFLLGDLEDSDEAPDDGDGDDDGSLGDDDFDKIGNSDVEEEKETNAAKN
*