Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>319845 [Arabidopsis lyrata]  fgenesh1_pm.C_scaffold_3002861 protein sequence BLAST
MFTLRECVEKLQLLKSPEERQRRLEEIPEIHDDPKMDPDCESEDEDEKEEKEKEKQLRPRSSSFNRRGRDPISPRKGGFS
SNESWTGTSNYSNTSANRELTRSYSGRGSTGRGDYLGSSDDKVSESMWTSARERDVQPSLGPEKPRSVSIPETTTRSSRA
VAPPELSPRFASEISTAPPAVVPQPVPKSNESEKIWHYKDPSGKVQGPFSMAQLRKWNNTGYFPAKLEIWKAKESALDSV
LLTDALAGLFQKQTQAVDNSYTKAQVAAYSGQSSQSEPNLGSTARTAPSTIEIPRNSQDTWSQSGSLPSPTPNQITTPTA
KRRNFESRWSPTKPSPQSANQSMNYSVAQSVQSHASRIDIPVVVNSAGTLQPQAYPVPTPDLINVSVNHSATLHSPTPAG
GKQSWGSLQTDHGGSNAPSSQNSSTSYGTPSPSVLHSQSQPGFPPSDPWKVAVPSQPNVQAQAQAQAQAQAQAQAQWGIN
MVNNNQNSGQPQAQAPANQNSSWGQGTVNPNMGWVGPAQAGVNVNWGGSSAPSTGQGIPNSGWGGPVQGQTQAYPNPGWG
AIGHPQAQPQAQVQAQAGTTSAGWMQPGQGIQSGNSNQNWGTQNQTAIPSGGSGGNQAGYWGNQQQSQNGDSGYGWNRQS
SGQNNFKGQRVCKFFREDGHCRKGASCNYLHN*