Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>337099 [Arabidopsis lyrata]  fgenesh1_pg.C_scaffold_1003664 protein sequence BLAST
MVSRRRRPSSFSSPRFFSLSSSSLKSYLVFLPQVAVQNLKEAEITEQDSLLLTKDLLRIAKLNIRVLFHENDALDMKIKT
LRQVDTEPRRLIDWNWMEKGVNDALQRKYLKTLVFCIRDGPMIEEYSFSFSYSDSGSQHVTMNVNRNGNKKHEGTPNQMS
TSACKMVPTLVQLLRTLDKTPDERTIVMKLLYYDDVMPPDYEPPFFRSCTEEESNYVWTKDPMIMEVGIIYRKHLVLALT
VKSLLDPSEDENDDMQEHGKSTKPDCVHDNQPSDTDTDSEVERVFLFSSDVYLIYTSNVHYKKQADANNGEVDEDATQNP
LENEQQLARVKNSRQLDTLELTDILSYFQDTSLVLSEDFMDQLEKEGVLSKTGEDTYIRNRDKAASLRIAGGPRIPKVQR
QYLKREVNVLGSSRDVDFSRPRPRKDRGRQNVQCIYFNSGYCRYGNSCKFSHRISGEEKTSSVATIMKIPERKRILSELP
EKIKKDMESVNISEKYAKTCLGEKRYGFIKETKRIGSLKVSDDKKFIVIYWMTQGVLEVFLLDEETRERLKDASGYIRDQ
GTHDLCWTYVSSDMVSASRKLHGWDLKYTPLCTRYLCQNLDPEDYRGSLKRCDEDGGGHRCYENDVESTLAYIQKFGIPE
EEEGKEVFVCRDRRVLCKEDKLHKITGIFKYPTLEEALVRLRTHPVGATLLGFDGWDGDQIYRGPCSKKAKLAGLHAVIM
IDCLKIHGETVVVCKSSSGTDLGMEGYKGYIVVSVQVMLMIAGKTETEENRGHRNCQVKPQHLLYDFYSVDMDYKEPRFD
KEDTEQKRKNEKFKVKIERYSQQVPPRIQGDHKRKQHQKHGKPQKRHNNLSLRGTKDSDSVVMDYVENVSGVKVFDPHHH
HIDQMTIPSSLVEDVYDCWFESGSMPYAHIHYPFENKELIEKNFPGHFVAEGLDQTRGWFYTLMVLSTALHRKSVVRNVI
CNGLVLAEDGEKISKKLQNYPPPLDLIDEYGADALWLYLINSLVVHAEPLRFKKGVLGVVKDVLLPFTWYNADGFLVQNA
RRLEIESCGPFVASDLEALQSSNVLDQWIQSATQSLVHFFRQEMDGYRLYTVHVIFIMNHDMVCSLLLAKFLHLSALKQR
GEMIEQRVTWMMTIIDLSRNIHERHSVKEMIVAHRDAEFLNDM*