Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>483950 [Arabidopsis lyrata]  fgenesh2_kg.4__3010__AT2G47680.1 protein sequence BLAST
MAVFSPTSTSSSSESLPLPSSNFASLPIMAMKRRIIDKILENRVTLIVGEPGCGKSSQVPQFLLEANMAPILCTQPRRFA
VVAVAKMVAKSRNSDLGGEIGYHIGHSKILTEGSKILFKTAGVLLDEMLDKGLNALQYKVIILDEVHERSVESDLVLVCV
KQFLMKNNDLRVVLMSATADITRYRDYFKELGRGERVEVVAIPSPDQRTIFQRRVLYLEQVAGLLGMSSDFSAYCPGPSP
SSADAEIKPELQNLIHDLILYIHEKEPDIEKSILVFLPTYYSLEQQWHQLEPFRASFEVHILHRSIDTEQALAAMKICRS
RRKVILATNIAESSVTIPKVAYVIDSCRSLQVFWDASRKRDAVQLDWVSRSQAEQRRGRTGRTCDGEVYRLVPSAFFNKL
EEHEPPAILKLSLRQQVLHICCTESRAINDANVLLAKAMDPPDPNVIDDALKMLLSIRALRKSPRGRYEPTFYGRLLASF
PLSFDACILVVKFGEMGMLREGILLGVLMDTQPLPIHHPFGDDSLFLEYLDHYFGGSKTICSGRREMVLMANFCAFQFWQ
RVFKDKHRLENLKQLLAKEKDKDLKLMFPEIEKEWCDFHNILQSSFYHVSEMYEDTLSSFHRFRPQFISSSDSLPTYYNP
YEFDHTCYIECQLSEDKYLHSEDEDNNQPPPEVRKCVSMPFVPPNAFQAYAVAENMASIIKEIRTQCTPSESDNGHGAIE
PEDYVEDGEAPVCVYFLNGFCNRGDQCTFSHTLQSTGPACKFFASLQGCRNGESCLFSHVMRRRATSYRLPPQCLAEEDG
SSTSPLLDLFPTSSEGCILVFDDSAMRFTSSIANCYPSWRILATSSSSDTLLCDSSLANTRIFWGLNHPYQTIISKAGGE
NPIPWSEVKCVLWFLNPDSYADTPEGQKTILQNFFEYMAIRLLGDNLYEIRVILTMNNVRFSLLQVEKLARDSFFFLGES
FPHNSVSFGEFQDTLTIQKPMQVSRPISYVFNLHSPSDIQFGDYTSLLHKSLHNK*