Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>485672 [Arabidopsis lyrata]  fgenesh2_kg.5__1664__AT3G52980.1 protein sequence BLAST
MNDVQNRIQQLEPENALKIIGYLLLMQHHNDRDMIRLAFCPDSVMRSMINCVKYELANNSHCDIPTSDHIQVRKFGSFTG
SSNQSLLVSISPPSVLSMGTSFWENTNDMDSSLQNNVYPEFSTSFFSQEKQGLSLRTSRRSLSLPEFPVKICHYFNKGFC
KHGNNCSDEEHVVSAVSLEKLEREIIYLLKSRRGAPISIASLPMMYYEKYGRTLQAEGYLTESQRHGKAGYSLTKLLVRL
KNTIRLIDRPHGQHSVILAEDVLKFVEYTGEKSEHGAILAGSRQIYLTFPAESSFTEHDVSNYFSKVGPVEDVRIPCQQK
RMFGFETFAYTEDVKHILAKGNPHFVCGARVL