Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>877838 [Arabidopsis lyrata]  Al_scaffold_0002_2432 protein sequence BLAST
MDSSLKNPNYGQWLPPSAPFPPLPPPPPHISHQFHFESLNNGYDRHHHKYHNYTHRQDFPPQYTVNQPPSYYSQPQPQPQ
PQPPALHVSYKPPGNFSHSSRNFSCTYSRDSAHSDWVGYMGRNYQLDYYGNRTRDCFNTRDLDGYSRSRDGFCSLGYAIN
DFGENYRDSWRFKSDSDRYSTSLGSGTSFGYGYDRYKDTLHRGSITHGTVNQRWVKGRENEKRFNSFRGKDHSDYASVKK
QRVGQKETSCTAGKVKFSKVTSEGGVPFSGKSVSSLQPQPCEDEIPKKEMDDPSSRDLQIEEAETKNFSQSQACEIGVDL
SVETVSRKESMEITSLNSTVDAGKGSPNVQPVEGTSVLLRSICKNKEGWSDVSIFDRGLSSAVYLEDVCFAPDHDLGLSS
HDPAEIPSVDQSSKIDCGGLKACLFESDVSLSKDANVGGSEFHFNRGLREKATTTCDYSPELEVENSFTIGYMSSSGTEM
VTDSECALLETQIIFGRISHCEIIEEERVRAENMDVDIQEEKVKITGEALECRTLGTDFVTIIKDSMFRWSSSSSLPGLL
TGKIQNETHAVAKVDKTNNSEERNKEEIFLDASQEQTITFHETVQSGSSLRHYLCSGQTSPASDAESCELPMDKYGDGGL
VEKPDGEPVEKLTDIPYDIGPQEVSLNIVNTDVYVGEALSFDGKVSGNESPSNSDVLLSRLHSYTDEKCNVSHVNDYVVA
LPPPDSQSETTLSSISEKTQKRANKFIHVAQKSYPLHDIKEDASPPISVTNHHTWHRKSTTSASPLVAVKPKVTVQCSST
YVRKGNSLLRKPSPGSLGDTQPLLSHSMPPSDSTSSGKCALSPGMDPSANGLPGSSNLPKLESSNPSKILYVKRKANQFV
TASDMHGASNSRIPPCVSYFRRSKSQLVRDSESLANQEKFLSDEASNSQTAAKMVSKRSSSLALSEFAIVRPFNHFNFSL
VWTLKEPISRKANRVHISLQKMVPQPVSWKRSTYWRRLMNPASVLLNGSFSIASLMTEHSISSRKLRMMRKRHTIYTRST
NGCSLTKSKVLSIGGSHFKWSKSIERGSKKPEFLSDIESSRSCPSESMKDTKISSNPKRLVIKNDKSVWIRNCDQLARDP
KKRTCVLTNEKVRWSLINVRLRVAKKMKYCQFFTRFGKCNKDDGKCPYVHNPSKIAVCTKFLSGLCANPECKLTHKVQQL
NHCPRGLCNNEPCPYRHVHVHQNAAICEGFLRGYCSDENECRKKHTYTCPVFEATGSCPQGSECKLHHPKNLSKGKKSKR
ASESWHKNVSGRYFGSPHKHLPESEPMFVNEVAADGVVFGREALDFIRLDINEHNASESMDSSTEESVSDDSNAHDSIDE
LIRPVGLMQR*