Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>890588 [Arabidopsis lyrata]  scaffold_103382.1 protein sequence BLAST
MEDADGLSFDFEGGLDSGPAQPSASVPVAPPDNSSSAAVNVAPTYDHSSATVAGAGRGRSFRQTVCRHWLRGLCMKGDAC
GFLHQYDKARMPICRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKLPGPPPPVEEVLQKIQQLTS
YNYGPNRFYQPRNVAPQLQDKPQGQVLTQGQPQEAGNLQQQQQQQPQQSQHQVSQTQIPNPADQTNRTSHPLPQGVNRYF
VVKSCNRENFELSVQQGVWATQRSNESKLNEAFDSVENVILIFSVNRTRHFQGCAKMTSRIGSYIGGGNWKHEHGTAQYG
RNFSVKWLKLCELSFHKTRNLRNPYNENLPVKISRDCQELEPSVGEQLASLLYLEPDSDLMAISIAAEAKREEEKAKGVN
PESRAENPDIVPFEDNEEEEEEEDESEEEEESMAGGPQGRGRGRGMMWPPQMPLGRGIRPMPGMGGFPLGVMGPGDAFPY
GPGGYNGMPDPFGMGPRPFGPYGPRFGGDFRGPVPGMMFPGRPPQQFPHGGYGMMGGGRGPHMGGMGNAPRGGRPMYYPP
ATSSARPGPTNRKTPERSDERGVGADQQNQDTSHDMEQFEVGNSLRNEESESEDEDEAPRRSRHGEGKKRR*