Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>906461 [Arabidopsis lyrata]  scaffold_502165.1 protein sequence BLAST
MDNQQKQLQQGVPELASLAGREESSVRGIDLMRVDQCEEIGVNQVPALSVPALSVAGTVAVPVSIEQEVKVVDEVAPVKR
KRGRPPRAQAKTPLHIRPPPPPPRKDDKEEDVCFICFDGGDLVLCDRRNCPKAYHPACIKRDEAFFRTTAKWNCGWHICG
TCQKASSYMCYTCTFSVCKRCIKDADYVIVRGNMGLCGTCIKPIMLIENIAQGDNEAVKVDFDDKLSWEYLFKVYWLSLK
EDLSLTVDELTKANNPWKEVPNTAPNVESRNDHTNNRALDVAVNGTKRRKTSDSPTLPNKLDGKNSNNILKKAPRDTSWA
TKELLEFVSFMKNGDTSVLSQFDVQGLLLDYIKKKNLRDPLQKSQVLCDLMLVKLFGKQRVGHFEMLKLLESHVLIQEKP
KGDKTTNGETTHAVPSQIEEDSVHDPAVRDRRRKMRRKTDGRVQNENLDAYAAIDVHNINLIYLRRKFLESLLDDINKVH
EKVVGTILRIKVSGSDQKVDIHRLVQVVGTSKATASYQLGAKTTDVMLEILNLDKREVISIDQLSDQNITEDECKRLRQS
IKCGLNKRLTVGDILKTAATLQAMRTNEALEAEILKLNHLRDRAKKLELLKSPDERQRLLQEVPEVHTDPSMDPSHASSS
DAGLGTTKQDNHIKAQSKGPQNKGAILNNVGNNAQKKYDAPILRSRNVVHADKDDCSKVHNNSSSIQETGKDDEESEIWH
YRDPTGKTQGPFSMVQLRRWKSSGHFPPYLRIWRAHENQDESVLLTDALAGRFDKATTLPSSALLPQEQKPFPHDSGRTG
VDVNCLQKNQTPVNTSATSSSSSTVTAHSNDPKEKQVVALVVCSGKVEDGNSVCPQSQVSCPASMSVVPGHVVSPDVRQT
PGTDQSNAVRADGNHNTTKTLDDGTNGGSAINGSVQAPNLNQESHFLDFPSPTPKSSPEDLEAQAAETIQSLSSCVLVKG
PSGVTWSTTTTATTDAATTTSSVVITGGQLPQVTQQNAVVLAAPSVKPIDLAADHATATQTSDNTQVAQASGWPAIVADP
DECDESVSDLLAEVEAMEQNGLPSSPTSTFHCDDDDDLTKGPEKDFFNPVARMSLTPETCRLDVSQASILDNVSAGKNSM
GTEAKDNTPFSHFGTAGPELLLFAPPAPAPTSISHDLTLTTTALRLGSETTVEAGSVERFPKSVLGVSSEPSPRSFISHD
SGSARGNTERSPRGSQQKRSNGHSRDRQWLNNSHNSSFNNSHNNRQWPYSNSHGYDHGSGSYAAHPPKGLKICKFYESGY
CKRGASCSFWHP*