Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>907942 [Arabidopsis lyrata]  scaffold_503646.1 protein sequence BLAST
MSKRILCKFFAHGACLKGEHCEFSHDWKDPTNNICTYYQRGICSYGSRCRYEHVKASRPHPSASSSSPVPLSSPASASNP
LARVFLPGVSERDLSPVPSSCLKPTWNLDSFHQDSLDSLDEVNTFNPGTVKPEEQPICSFAAAGDCPRGDECPHIHGNIC
PTCGKCCLHPFRPEEREEHKKVCEKKQKQLEALKISQEIECCVCLERVLSKATPAERKFGLLTECDHAFCIACIRNWRSS
SPSTGMDVNSTLRACPICRKLSYFVVPSVIWFSAPEEKKEIMDNYREKLRSIDCKHFSFGDGNCPFGTSCFYKHAYHDGR
LEEVVLRHLDAEDGQTVIAKDIRLSDFLESMHI*