Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT1G29570.1 [Arabidopsis thaliana]  zinc finger protein-related  protein sequence BLAST
MADAGDNQQEAERRSDETESRSIKEPKEKEDEDENPQDQIQSKERMRQSSPYPVRPGKKDCQFYLKNGLCRYRSSCRFNH
PTQRPQELPVRICKHIMDRNVAEPMYQDWRESESERRFDERTQRTFGDERTQRRYGIEYSGARPEKRSKIVPDFQMRDPR
HHDTEWRFERERMERIERQRREAEENLQEQRQRDSIERQRREAEENLQEQRQRDSIERQRREAQENLQQQRQRDSIERQR
REAQENLQQQRLQDMPENHNVDDQQNLQEQRRISIEKERTEARLRLEQIRPTVSFPINEFIRAVVLLRELIENWDDKAWK
K*