Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT4G29190.1 [Arabidopsis thaliana]  zinc finger (CCCH-type) family protein  protein sequence BLAST
MMIGETRRTYPTVEIPPWPVLEELTTSEFFSPVMNSPDCSMLEALAGLQRYLPSNEPDPESYPDLLGPDSPIDAYSCDHF
RMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPC
KDGGNCLRKICFFAHSPDQLRFLHTRSPDRVDSFDVSSPIRARAFQLSISPVSGSPPMSPRADSESSPMTQSLSRSLGSC
SINDVVPSFRNLQFNSVKSFPRNNPLFGFGSPRGSILGPGFQSLPTTPTRPGNLDIWEYGLEEEPVMERVVESGRELREK
MREKLHKENCMDRVAQDPDQNLGEAPDVGWVSDLLM*