Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>138954 [Chlorella sp. NC64A]  IGS.gm_22_00195 protein sequence BLAST
MDDFTFDFERGLESQPAQRGYQAADDGMGGRGNAEPKPRNYRQTVCTYWLRGLCMKGDTCGFLHQFDPERMPVCRSLLKF
GVCKEPDCPYKHTLEAIKECNMYKLGFCIYGPACRFKHTRQLAPPPDPETLEAAKPREHRNLNIVANQANENIMPEREAR
GPRRPRPGGDGGGYMALPGAGGGGGAGPSAVQQYAGPGGARQPGQQYGGQQAPGYADSALLAAVGQADLRYGF*