Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlorella sp. NC64A Transcription Factor Database


>33881 [Chlorella sp. NC64A]  estExt_Genewise1Plus.C_20426 protein sequence BLAST
MAGRLLNDPEADGWERSDFPIVCSTCLGPNPFVRMQRIEYGGQCHISNRPYTVFRWRPGTDARYKKTIICQEVAKAKNVC
QVCLLDLEYGLPVQVRDQALGMANEGLPESDPGKEYALQRMQVEGDLDRSQYETHKPNDLLMKLRRTEPYYQRNRARICS
FFVRGECKRGAECPYRHEMPTSGPLSEQNIKDRYYGVNDPVANKMMDRANKLAKLTPPEDQTICTLFVGGVTDDISKDDL
RDQFYPFGELRSVKKVASRKCAFVTYATRGAAERAAEELANKLVVKGERLKLLWGKPQQPRPAAEGGGGGAAAAAGPASG
YPPAYMPAAPGGGGYYPSMDPMALGSRQQQQQQHGPPRGMPRPPPGGAPPPVPAAKN*