Plant Transcription factor database - Universität Potsdam
version: 3.0

Coccomyxa sp. C-169 Transcription Factor Database


>84285 [Coccomyxa sp. C-169]  estExt_fgeneshCV_pg.C_190083 protein sequence BLAST
MDEVKSNSLDDSEDHQSNTFRIFSYKVKRCSRSRPHDWTQCPFSHSGEKAKRRDPRRFAYTGAACPDYRKNASCRRGDKC
PFAHGVFESWLHPSRYRTQCCTDGVACKRRVCFFAHQESELRKPEDDPALLAAQLQAEALASTETYQQILASASLDSVPE
ALPASNANPQLNLAILQSLLQNNGAAAQRLPINWAVDGESQERGRMYQLQALLAALQLRAPAPLPPQPAHSDALSNLDRI
ELGRLLAANQALVQQQAEREMLQRSSFEAVRRNSMSSDAGMGSDLGRQDSYLSHSGVGLPNNGDGGYGDGRGNARNNFSP
GVRRMSMDNARSQINGSAGLDPRILAALAAAQRVNAPGGQPQGRNTAAYRRSVDMGMLAHAAAMGGAGRHGGNSAGFPKQ
FGEQTSIPEGSPGIESSAQPQQEATALANAFNQGPGVIDGFMAGARQPPGMEQLIGLAPADQAALSASVLQSQDSLGNFQ
RAPSGYGSAQINGQSQEVRRYLEQLGGQHSGQLTRQASDMSTQGSGHFALSGLGSFGHFISEGSGPLSSLGQASSGLGSF
GQPLPQASGHIGPMQNHIGQPRYSPARHSFSSADSLGRLSDVQQQQQQAHMEDAINNGGWGGAPMTEGGDPQPRGGYQGN
NAGGPPAERGLAASLLHPEEGARAGEEQYVGSGSSTPSRGPPTPGVAPQHGMMSPREQPPSMHSSLYASSPASHTTTYET
SPMSMAMGLTGQPPIPEEGPGWPHTLQQQQQAASAGACHARRMPTLLEQLQLYERQRHSSMPHFHAHASLAMARNTSFES
LSAELPRSISDMNLADHNLGSARMPTSIPASST*