Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD021780 [Oryza sativa subsp. indica] Chr06_4421,1632,,,1,1632, protein sequence BLAST
MKGEACGFLHQFDKARMPVCRFFRDFGECREPDCAYKHSYDDVKECNMYKMGFCPNGPNCRYKHVKLPGPPPPVEEVLQK
ILQIRSFNKFNQHRHNNYNQQGERPQHPQGSGLPNQNSIDNTTTTTAQPAVGQQAQTTNQQPPQQQQQQQQQQQQQQQKP
NTNDQVQSVPNGSSNQATRIATPLPQGPSRYFIVKSCNRENLEISVQQGIWATQRSNEAKLNEAFESIENVILIFSINRT
RNFQGCAKMTSRIGGYIGGGNWKSAHGTAHYGRNFSIQWLKLCELSFQKTHHLRNPYNDNLPVKISRDCQELEPFIGEQL
ASLLYLEPDSELTAILIAAEAKKEEEKAKGVSADEAADNQDIVLFDDNEEEEEEESEEEEEGNGQESQGRGRGRGMMWPP
QMPMLRGVGPMMGGRGFPPNMIGDGFSFGGGFGMPDPFGVPRGFPPFGPRFPGDFARGGPMPGMVFPGRPPQPGGMFPMG
LEMMMGPGRGPLMGGLGMGGPGRPNRPVGMAPFMPPTTPPNNRGTKREQRRAGGERGDRLSPG