Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus tauri Transcription Factor Database


>32611 [Ostreococcus tauri]  0400010557 protein sequence BLAST
MTSASTSSRAVVGRIVGRRRVSARLAFYDLLVEASATVAWSTTTDDGDDASRGGRLGDRSSSASLEGLGRSESVVVELVV
KLGAEAFADEDALAAARREAFKLGNVVDVVGKLTRGRRDGQTKSRSTAAWVLTCEGVNEVVEAWATANPGKCFARELYVR
PAAPRDDSAESKPGDTPAPCKFFINNGYCAKGDACKYAHDRAVQREWIAARKAKRREIAATQYGDPHGDAVANKSARAVK
FAEWLRGKFGDDVLNAGTGILDVAGGRGDISFELFTKQGIKSTLVEPRARKLNKQQHKWLKAREKKFKTESDDGASFQKP
ELCEQIKTEFTSENWHLFKDCSVVIGMHPDQATEAIVDFANLYDKPFAIVPCCVFPELFNHRRDRQGAPVTERMALVEYL
ADKTGGSVEYLDIEGANQVVFRTS*