Plant Transcription factor database - Universität Potsdam
version: 3.0

Physcomitrella patens Transcription Factor Database


>14781 [Physcomitrella patens]  gw1.135.30.1 protein sequence BLAST
YPQRPGQKVCAYYMATRTCSFGVTCRYDHPACGTGGQVTAVGTPVDPCLLPQRPAEPDCAYFMKTGECRYGPQCRFNHPK
EKLEPSNTDDQYSAASSAAFGNPATAYNTNGLPLRPVTCARDVQGEGNCVFYGKTGSCKHGPACRYNHPEILLSMRMQLD
NNLSVKKIIPMQLSRSLETGQSTCTQQSNQDKFYIKTGECSFGATCKFHHPPDRIPTGIPKPAKNQGLVKLSLAGLPRRE
TEAPCAYYMKTGACKFGQTCKYDHPPPQEIIAKAVEQA