Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>424416 [Populus trichocarpa]  gw1.87.30.1 protein sequence BLAST
DAMWQMNLRSSETMEAGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGEFPERIGQPECQYYLKTG
TCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSP
TTPGQQSYPGGLATTWSRASFITSPRWQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPESQQQTGNSQIYGTSRHSE
SVNAGSQGTFSPYRSGSAPLGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLR
PGEPLCIFYSRYGICKFGPSCKFDHPMGVFTYNLTASSSADAPVRRLLGSSSGSPGLTLSSEGLVEAGPTKPRRLSLSEP
RQMPPGDDNIDTGG