Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>656369 [Populus trichocarpa]  grail3.0010011801 protein sequence BLAST
MAKQLYGYGAPATTSASRSRTDSYLTDSVLTRYLGTGSDPLSSDSSKYSASSSMYLTQSDSALRYSVDRGIASAAAAATS
PHLSSWPPPPGVDAPSAVDSLVPGLKRTPEVLYHPTLLGAHSTIGQSEDWYSTNALAKRARFETTSHLPIYPQRPGEKDC
AYYMLTRTCKFGDTCKFDHPVWVPEGGIPDWKEVPPIATSETFPDRPGVPDCPYFLKTQRCKYGLNCKFNHPKEKMSLGV
SENTSISALPERPSEPPCAFYMKTGICKFGATCKFHHPKDIQISLAGQGNDDGVQTNSVVDNGGITGDVNVIKALVSVTP
ALLHNSKGLPMRPGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAAIGHPIIAPSMANLNLGVFSPAASIYQTIDPR
LSTLGVGPTVYPQRPGQAECDFYMKTGECKFGETCKFHHPIDRSAPTAKQTEPQTVKLTLAGLPRREVWIGARN*