Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>752023 [Populus trichocarpa]  fgenesh4_pg.C_LG_I001626 protein sequence BLAST
MFLKVLSVYNLVEKRRCGGDFVMCSGTKRKPTHTGFNMENEFRKEDGVCYDFSGLLELSALNDLIGFKKAIEEEGHDVDM
PGLWYGRRIGSKKMGFEERTPLMIAALFGSKDVLNYILETGHVDVNRGYGSDGATALHCAAAGGSSSAPEVARLLLDASA
DPNSVDANGNLPGDLIAPVVKSGSNSRRKTLEIMLKGGTSGEETCVLADQIADEMDGMEQQEVPMPRVSKDGSEKKEYPI
DLTLPDIKNGMYGTDEFRMYTFKVKPCSRAYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPEFRKGSCRQGDACEYAH
GIFECWLHPAQYRTRLCKDETGCTRRVCFFAHKPEELRPLYASTGSAVPSPRSYSANGSIFDMSSISPLSLGSSSVLMPS
TSTPPMTPSGSSSPMGGWTNQSNVVPPALQLPGSRLKAAFCARDMDLDMELLGLESHRRRQQLMDEISGLSSPSSWNNGL
STASAFTASGDRTGELNRLGGVRPTNLEDMFGSLDPSILPQLQGLSLDGSTTHLQSPTGLQMRQNINQQLRSSYPTSFSS
SPVRTSPSFGMDHSGGAAAAVLSSRSAAFAKRSQSFVERNAVNRHPVFSSPAKVMPPNLSDWGSPDGKLDWGIQGEELNK
LRKSASFGFRSDGSSFATAAASVPATVGEPDVSWVQSLVKDTPPVKPGPLGLEQQQQQQCHLNIGGSEMLPAWVEQLYIE
QEPLVA*