Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5007510 [Sorghum bicolor]  estExt_fgenesh1_pg.C_chr_70468 protein sequence BLAST
MDYTNAIHIIPDAAGPDAWTNAAPSTGGDAAIWATEDDYRQWNADPGYGDRNPSSRAGSEQPPPGKKARGGAGAGGGGGG
GGGSDGGSGSSTSKSRAIGKMFFKTKLCCKFRAGTCPYVTNCNFAHGMEELRKPPPNWQEIVAAHEEATEQREEHQIPIM
TSGSVVAGDGGGGGSSQGGRAYKGRHCKKFYTEEGCPYGDACTFLHDEQSKARESVAISLSPTVGLGDTMLLPLPME*