Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5032111 [Sorghum bicolor]  Sb10g027200 protein sequence BLAST
MDDGDGGLSFDFEGGLDSVPAAGGGGPVPSSTDPGAGGGGGGDGPGMHGRGRGRGSYRQTVCRHWLRGLCMKGEACGFLH
QFDKARMPVCRFFRDFGECREPDCAYKHSYDDVKECNMYKMGFCPNGPNCRYKHIKLPGPPPSVEEVLQKILQMRSFNRY
GQNRNNNYNQQGERPQHPQGSGMPNQNSAENATAAAPPAGGQQAQTMNQQPPQQQQKPNTNDQAQGVSNGQQATRIATPL
PQGPSRYFIVKSCNRENLEISVQQGIWATQRSNEAKLNEAFESTENVILIFSINRTRNFQGCAKMTSRIGGYIGGGNWKS
AHGTAHYGRNFSMQWLKLCELSFQKTHHLRNPYNDNLPVKISRDCQELEPFIGEQLASLLYLEPDSELTAMLIAAEAKRE
EEKAKGVSADEAADNQDIVLFDDNEEDEEEESEEEEEANGQESQGRGRGRGMMWPPQMPMMRGPMMAGRGFPPNMMGDGF
GFGGGFGMPDPFGMPRGFPPFVGPRFPGDFARGPMPGMGFPGRPPQPFPLGLDMMMGPGRGPLMGGMGMGGPGRPNRPMG
MAPFMPPPPPNNRAAKREQRRPGGDRGDRFETVSSDQGNRGHDNTGNSGADGARAQSGDRYGRSALRDDDSESEEEAAPR
RSRKR*