Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5035155 [Sorghum bicolor]  Sb03g004260 protein sequence BLAST
MESEGNAAAAGAGAGAGAGNWEAPNGVIVLPAGSAAPRFLQQEPHYLRRKREMEREQQDAEAAGADPGVLGLDLRQPPEK
VYYKTRLCEKFEAGKCAYEDGCTFAHGFDELRPPLPVPTALIRRRSPLRPRSSSPGGAAADGSQVSGGYLRVCFEFRDTG
ACHRGDRCAFAHASVAADMPFPGGPRSVEHALRNASPYVKAYSSPGSAASAHRSSSTTSSFAPSSTRAVPSIPADAAGEG
RRRKVTRLELLSRKKTSGIYGDWPGQE*