Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>45393 [Selaginella moellendorffii]  gw1.68.205.1 protein sequence BLAST
KPCVYYSRGFCKHGSSCRFSHDHIAGDGSSPSPSSLERLDRELQELLSSRTSPVSIAALPQLYYERFGRPLQAEGYLTES
QRHGKSGYNLTRLLSKLKGSITVIDRPHGQHAVVLAEDAHKFATFAGEHYDLSGVNPSSRQIYLTFPAESSFSEDDVSTH
FRAYGPVQDVRIPFQQKRMFGFVTFVYPETVKIVLSE