Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus lucimarinus Transcription Factor Database


>30929 [Ostreococcus lucimarinus]  eugene.0400010005 protein sequence BLAST
MVSYARAHDRRAPAIGGAVKPVREGEREYGRVVTLKESFGFIRCGARVEDPSQGDRRARGGPPREAQVFFHASEFHRELA
NRDKPALDPGDLVSFVCGPSPNRDGLNAFDVQKCDDVDVAWRMVSENVIGAVSRTLRGKMKRDAYGGRVAYQAYDEGDAR
ASTEEESESRRDAESKLEQDDESAVDMDAMKDEIEFTGADLAEACRLSKLRQGVKVKFTLSFDPYSRAMRASDIREAFPQ
SDNSAEAATGVDSNDWNREKAPLAEDEFGVISIIKSSYGFIKCCSRPKDLFFHFSELNEDVDAARTGQEVSFQVTTEPRT
GKVVAAGVRFAPKGSAVFATVDDRPCRGVCTTKLMFTKGFPSKDGDRSTPKGVVEEMTGRDGETKKFAFDRSGLLDARQN
PREGELVQFCVQTDKRTNVASACKVQIMRFTGKVTSTKSDGLYGFVEHVDQGTGVQGKAFVHGAEVEGQSKLNVGDELEY
ALQVGRKADEFAAKRVKVVVAAPVDPNAAPSRPDSPRVNRDNQFSGSQFKITKGPDGTRGFEMGRGKGLAEKAAANFSQL
KIEAQSFVPLPLGGAENGDESPGDAVSVKASAVEDAP*