Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus tauri Transcription Factor Database


>33483 [Ostreococcus tauri]  0600010330 protein sequence BLAST
MGDGAEPSARRRGKVKWFNCTKGFGYITPDDGEPDVFVHQSALKMEGFRRTDGRRFATQGDSVEFDVEHESPTDERLKAV
CVTGIGGAPLKAPPRTNYRRSSKKRGPRRESDGPKDESKTTQRTA*