Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>186937 [Selaginella moellendorffii]  estExt_Genewise1Plus.C_1400004 protein sequence BLAST
MSDATEKKSGKVKWFNSAKGFGFITPDDGGEDLFVHQSSIHADGFRSLKDGEAVEFTIDRSEDGRTKALDVTGPEGSFVQ
GAGADSGRGGGGRFGGGGGRSGGGRGDGCFKCGQSGHISRDCPSGGGGGGGRGGGGGGRNCYNCQQSGHIAKDCPNAPQ*