Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os01g48700.1 [Oryza sativa subsp. japonica] transcription factor Dp, putative, expressed protein sequence BLAST
MAPPCGDAAAAASAAPGLANLLIREGAGLPSRPERYPPFRPCTSDSFAPISREGDDIPPQKKSVSLRSGGGGNAAEREEG
GANRNGKKEKTGAQRITGWGLREFSKIVSKKVEAKGRTTYNEVADEIFAELKSITQNGLEFDEKNIRRRVYDAFNVLIAI
RVIAKDKKEIKWMGLTNYRYEKIQKLEEVHKELITRIKNKKKLLQEIEKQFDDLQNITLRNQASQRPAESVNGILLPFLL
IKTSRKARVEIEISEDSKFARFDFNGAPFTMHDDVSILEAIRRNKGRAGLSIHP*