Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>321945 [Arabidopsis lyrata]  fgenesh1_pm.C_scaffold_4002002 protein sequence BLAST
MAGTSSPGKCSMWLDLNREETVEKNNEEESSVEDEEQVTSSNNVRQYVRSNMPRLRWTPDLHLSFVRAVQRLGGPDRATP
KLVLEMMNLKGLSIAHVKSHLQMYRSKKLEPSSRHGFGAFMSGQRSYLIDMIDSRCIPYGDLRHAYNSKTVPSRVLNQDA
VITNLGGNFLTRPSSWFSGLCRNDQDSTENKTLPLLEIRKTINEKRVRDEEVSSVKRLKSMSGGGIQLPEFGNCRQKPTD
DINTMLSLSLFSTSSGDRNIAPSDIVER*