Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>471638 [Arabidopsis lyrata]  fgenesh2_kg.1__1592__AT1G14600.1 protein sequence BLAST
MGRCGRSSDGRIGGVRPYVRSPVPRLRWTPELHRSFVHAVDLLGGQYKATPKLVLKIMDVKGLTISHVKSHLQMYRGSRL
TLLGKPEESSSPSSRRRRQDNEEDHLHDNLSVHARNDCFLGFHSFNFREQTSATDNDDDDFLNIMNMERTKTFAGNGESI
KFQSHHFLEAENTKNNWKSTWRENENEHEEEKLSLSLSLNHPHNHQQRWRSNASSSLSETSEAVSSSSAPFIFRDCFASS
KIDLNLNLSFSLLHS*