Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD001406 [Oryza sativa subsp. indica] Chr01_2089,966,,,1,966, protein sequence BLAST
MVVVGDEAVQRAVVLRLGVNFRATVCSEINAAVEMLRERTKEFDFAVISEESIRSLRPEIMKFLGEETGLRLLVLRNEGG
NEYSVVPVVRRSDTVCIEVSHASSARLPAASPHDGSNGSTAAAAAAVASSVRRATNGRKHRRRAGEKSSQHRQRKKRFIW
TPELSKIFIEIYEELLLTGINPVPTKILELMKLRIGPMNDPELTRNTVSSYLQKYKAYLLKQEQKDQQLPIDDNTNTSSI
KSQQGSASLQQQIMNYGENDSMDNQSIILSQTRYNEHSNKQPKLLTANYHGPRNMHHHHKNTNMQPSNVLLDQSKGIQYV
L