Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD012075 [Oryza sativa subsp. indica] Chr03_5502,1047,,,1,1047, protein sequence BLAST
MGLDVGEIGMGLDLSLDLKMFAARSAVRMAAAAAKEATGVEACIRSLEEERRKIEMFRRELPLCARLLADVIELMKEEAG
KRRKDGDDAEAKAEDGDKTKWMSTAQLWVDSRGSDADSENDRRSGSTSPASRLLGGAEESSSRAVAPPPYFRREERVVLR
PAMPLLPPASHRSPPPAAAAAATAAGDDHRHVVASSFATAVPSPVPAALSLQAQAQQQQQQARKSRRCWSPELHRQFVAA
LQQLGGPQVATPKQIREVMKVDGLTNDEVKSHLQKYRLHNRKSPGTASASHSIVLVGDLWASQEVSCSQSGSPQGPLQLS
GSGVAVSAATAGDSCCEDDDKSEGYVRK