Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD019173 [Oryza sativa subsp. indica] Chr06_114,1038,,,1,1038, protein sequence BLAST
MELFPRQLDLSLHISTPSCFSPSPASASTTASSWPWTTKQQLPEEEEAAATTSTTTSSRSAPPLLLCNSDVFSTRGSSTT
NTNHHADGGLANSQQLKAAARQPIHGIPVYHGHQQQQRRQLHHPYDVVGTRQSDGGRRLFSHHVGVGVTPSRTLSSSSSS
PARLLPRLPPGRRSVRAPRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTIKNTDRPVS
NAGQNNDGFDNASAGDISDDSFTDGPLRQNKSMLASEQNDTNIYSGLWSNNSSGKVGLPIREPANEIYRRYLKNTKLSVD
LETSMLRLPGRPNLEFTLGIGKASQ