Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD020994 [Oryza sativa subsp. indica] Chr06_3205,1542,,,1,1542, protein sequence BLAST
MVLDLNEGFGEGSEEGGVGEDGDEEDDDEDDDDDDDDDGGSTSEVAGGGRSSSNNSSTNHNSGSDKDHDMNSSSSKADGG
GDRVPTVRQYNRSKLPRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRSKKLDHESGHER
GAISSVFSPMEFHMRRGDHRFHHHDMFFQRAAAAGVSPFSSRMLHENGGGFFASRNPGLPESSRLYGLFQRRQQAPMQKF
DFKNCDSFSRNQEWAFNQQHAAARAAGAVNGHGPAKGLIHEMIFQKEGKPTSHLFDVRDAIASTRVTSATTAAAADHRLD
GAGKAGNFDWIGSSSSRPLTRTMSAATAATMGDHHHLRWRGGAAGSGNTTASSDPVVASEAALGSLLERAKTKATEAMRL
ETPVKMTAAAVAAEEINSRTPDLQLSLSPNAGDHRSAGKKRKFLSEQEVDSDKQQLPLTLSLSLRGGGDNGGGGGGGEAA
GRLEEEMTGSSSSKKAALGLSTLDLTMSIKALE