Plant Transcription factor database - Universität Potsdam
version: 3.0

Physcomitrella patens Transcription Factor Database


>46954 [Physcomitrella patens]  gw1.37.249.1 protein sequence BLAST
DPKPRLRWTPELHERFVDAVNQLGGADKATPKSVMRIMGVKDLTLYHLKSHLQKYRLGKQLHRDSSVHEANKDITEAIRL
QMKVQRRLQEQLEVHKNLQLRIEAQGKYLQTILEKAKETLAGHTSASPDLKAAHAELTEL