Plant Transcription factor database - Universität Potsdam
version: 3.0

Physcomitrella patens Transcription Factor Database


>61021 [Physcomitrella patens]  fgenesh1_pm.scaffold_311000005 protein sequence BLAST
MAMDMARIEVEPLVEVHNNTNNLLVHCVLDALPDSSPCLKSSETSFEAVVVKEDEEGGRPLFGKPELHPASPSSDTAAAA
NGEFARCLNFVTEADCGDVGVQCFEDFGTLPDCGEAGISREEGGGRDGEQVELLESMSLDGSRNSENLELGELGELLQGS
ETLDSVPGNEVGEEEALLLAKAAKATGVVVSASDSGECSSVDRKENQQSPKSCKSAAPGKKKAKVDWTPELHRRFVHAVE
QLGVEKAFPSRILELMGVQCLTRHNIASHLQKYRSHRRHLAAREAEAASWTHRRAYTQMPWSRSSRRDGLPYLVPLHTPH
IQPRPSMVMAMQPQLQTQHTPVSTPLKVWGYPTVDHSSVHMWQQPAVATPSYWQAPDGSYWQHPATNYDAYSARACYPHP
MRVSLGTTHAGSPMMAPGFPDESYYGEDVLAATMYLCNQSYDSELGRAAGVAACSKPPETHLSKEVLDAAIGEALANPWT
PPPLGLKPPSMEGVIAELQRQGINTVPPSTC*