Plant Transcription factor database - Universität Potsdam
version: 3.0

Populus trichocarpa Transcription Factor Database


>557338 [Populus trichocarpa]  eugene3.00090598 protein sequence BLAST
MGSLSSELSLDFARPSTAKALPFLPKTIADFLKEVSVIGDSAVKVLKVDGFIKDLEEEKRKIDAFKRELPLCMLLLNDAI
QVLREEPMQRGASKNQQPVLEEFIPLKKNIDDHHENDGLIEEKDSKDKKNWMSSVQLWNADDHHPSTDYLFDPKQNLKLE
SKTNKKGNQYGNEDAFQAGIGRTAARTFMPFKACSGLSSKEEKLPVPSLSLSTPGIKSLKEESNSTGSRSSCSRSVSTIS
GPNSDSNLRNGPQSQQQTARKQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLHTRRV
TPATAAAPANQSVVVLGGLWMTQDQYGDSSKATSSQSGSPQGPLQLAVNTGGTSTTGGDSMEDDEDAKSEGYSWKSHSHR
SGKDDV*