Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>423935 [Selaginella moellendorffii]  fgenesh2_pg.C_scaffold_64000075 protein sequence BLAST
MQLEVEMDQGASSPPLHNSRKRLSSVEEDDLDAPGSSDSNNTVSGDGSSDGATVLGGPFGSSSARSSVRQYIRSKMPRLR
WTPDLHECFVRAVDRLGGQDRATPKLVLQLMGVKGLTIAHVKSHLQMYRSMKNDENGPVVMEERKGEQAQAAVASDASLL
HHPWTPQLQQIRGEKKCRDNPNAQQQYYAHNYFHRPVLQPLDCHARTEDAWSQIASPNQSQEWLSRLSIAATKCYSERFN
DLQIGWRKNHHTLFQQTGGDDNTLRSRSLEREESRIHSSILLSQNRINSCPALIHFDEILEGSRSAMKHHENFNFHPQKL
CYITDLCTKTTLEPRELTFY*