Plant Transcription factor database - Universität Potsdam
version: 3.0

Selaginella moellendorffii Transcription Factor Database


>47303 [Selaginella moellendorffii]  gw1.59.405.1 protein sequence BLAST
KRSMRARRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRTIKTTDKASSSSG