Plant Transcription factor database - Universität Potsdam
version: 3.0

Coccomyxa sp. C-169 Transcription Factor Database


>77422 [Coccomyxa sp. C-169]  fgeneshCV_pg.C_scaffold_25000066 protein sequence BLAST
MQGITVTCLVACVDDVEGDSLASAVRQDMDLSCKIPAGVGGSHPQLVVGTLDINQGVNLPGGHLIGLEPEGAVARIQRGY
LSNICTQKAVRRTGVAMRLIRAAIDEAASAGIRWLYVHAAEQNTAAVQLYTQQCGFEIEQEEGAGIAIRLNRPRRYLFRQ
RLG*