Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis lyrata Transcription Factor Database


>490909 [Arabidopsis lyrata]  fgenesh2_kg.7__342__AT4G36988.1 protein sequence BLAST
MTAVTAAQRSVPAPFLSKTYQLVDDHSTDDVVSWNEEGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIRQLNTYGFRKTVP
DKWEFANDYFRRGGEDLLSEIRRRKSVIASTAGKCVVVGSPSESNSGGDDHGSSSTSSPGSSKNPGSVENMVADLSGENE
KLKRENNNLSSELAAAKKQRDELVTFLTDHLKVRPEQIDQMIKGGKFKPVESDEESECEGCGGGGAEEGVGEGLKLFGVW
LKGERKKRDRDEKHYLVGGSGMTELKNVDFHAPLWKSSKVCN*