Plant Transcription factor database - Universität Potsdam
version: 3.0

Galdieria sulphuraria Transcription Factor Database


>Gs27360.1 [Galdieria sulphuraria] gb|ABV89640.1|__heat shock factor 4 [Brassica rapa] protein sequence BLAST
MFVGNHEKDERSEFSSKDLSSSSADDNAGNNKRGETSTREDVARFVRKLVSFVDDPSCDDIVSWNETGTGFVIWDSNAFC
LKVLSCYFRHTNLSSFVRQLNQYGFRKTAHSRWEFCHDSFRRGRPELLGEIKRVSVSSNVSGKSSKALLHAQIPTFVDFS
PSFGLPFTYSAADLQQEFMDMDRVESTLVNLQEEAKLLMTNLEESKLQCDELKLYLEYGNSATQQSDVAQDKVPEPKAVG
QSSSNSLKNDPSFVPSFNRIPAQEQQLRDSQMSEALLSQQRLDEGIQRQGSSVEGFSSLPHPTRFTSELVYRRWIKAQLQ
REAELRKLQLDREWRPS*