Plant Transcription factor database - Universität Potsdam
version: 3.0

Galdieria sulphuraria Transcription Factor Database


>Gs51330.1 [Galdieria sulphuraria] emb|CAA53761.1|__heat shock factor [Arabidopsis thaliana] | Symbols: HSFA1A, ATHSF1, ATHSFA1A, HSF1 | HSF1 (ARABIDOPSIS HEAT SHOCK FACTOR 1) protein sequence BLAST
MRSGTTLSSLHNSHTEDATSLRASSYAGNIPMPTPFLSKLYELVDDPNTTNLVSWMDSGDSFMVHRPNEFAREILPRYFK
HNNFSSFVRQLNQYGFHKLDPDRWVFGHANFVRGRKDLLLKISRKKSHVAPEGYHKVKGTTSNTTSETVSHRMGVTDIER
SQPVIELGNYGNSNVLEILKRDKNALYQEFMLSRQREEELRQRCIANERRIYKLENQMEQVRQFFVSYFEPILQYYSLSR
KRKRLPAPENAENTDSKQTNGFDYSHSDGEDYIAKDQLGDTQASVLREASQKLLLDLFRLKRSNSPSFPPASVQELRDSN
RREHADMESRAQRLFQGGENISKPPSFVVEEGGPDEERTSQTRSYSFSDSRNQEADTELWSRGNFLYDYGDSVAQTQEEH
LFSDMTPLQVEDELHSSTQSNPIAMSGQQPLEKNKFAYLPINYNGNEEMNAADVRLQSSLNRIFSKDKQEEDSYGMFEMD
DMIREFPYRDGSVSLDEIGDIASLLEGEEVNYERLER*