Plant Transcription factor database - Universität Potsdam
version: 3.0

Micromonas pusilla CCMP1545 Transcription Factor Database


>9563 [Micromonas pusilla CCMP1545]  gw1.18.185.1 protein sequence BLAST
VSWSESGREFTIHNVAAFSNTLLPRYFKHANFSSFVRQLNSYCFRKCDNVRWSFSNPYFVRGGESAMVRIRRR