Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD012247 [Oryza sativa subsp. indica] Chr03_5761,963,,,1,963, protein sequence BLAST
MNYRVVNPVKVESGPSTGVANGQPPRPMDGLADGGPPPFLTKTYDMVDDPTTDAVVSWSATNNSFVVWDPHLFGNVLLPR
YFKHNNFSSFVRQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKSIKRRKPPNSSPSQQSLGSFLEVGHFGYEGEIDQLKR
DKHLLMAEVVKLRQEQQTQLFSQSEMRKELEEFVSKKRRRRIDQGPELDSMGTGSSPEQVSQVMFEPHDPVDSLFNGVPS
DLESSSVEANGGKAQQDVASSSSEHGKIKPSNGELNEDFWEDLLHEGGLDEDTRNPAIDDMNLLSQKMGYLNSSSTKSSQ