Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. indica Transcription Factor Database


>OsIBCD027305 [Oryza sativa subsp. indica] Chr08_4380,1122,,,1,1122, protein sequence BLAST
MGEPSPPPPAPAAEAAGVGVGQQQRTVPTPFLTKTYQLVDDPAVDDVISWNDDGSTFVVWRPAEFARDLLPKYFKHNNFS
SFVRQLNTYGFRKIVPDRWEFANDCFRRGERRLLCEIHRRKVTPPAPAATTAAVAAAIPMALPVTTTRDGSPVLSGEEQV
ISSSSSPEPPLVLPQAPSGSGSGGVASGDVGDENERLRRENAQLARELSQMRKLCNNIILLMSKYASTQQLDAANASSAA
GNNNNNNNCSGESAEAATPLPLPAVLDLMPSCPGAASAAAPVSDNEEGMMSAKLFGVSIGRKRMRHDGGGDDDHAATVKA
EPMDGRPHGKDEQSAETQAWPIYRPRPVYQPIRACNGYEYDRAGSDQDGSNST